Help
RSS
API
Feed
Maltego
Contact
Domain > harivishvaskyfiniatathawade.com
×
More information on this domain is in
AlienVault OTX
Is this malicious?
Yes
No
DNS Resolutions
Date
IP Address
2025-11-12
77.37.53.222
(
ClassC
)
2025-11-14
92.113.23.128
(
ClassC
)
2025-12-02
77.37.76.46
(
ClassC
)
Port 80
HTTP/1.1 301 Moved PermanentlyDate: Tue, 02 Dec 2025 21:27:38 GMTContent-Type: text/htmlContent-Length: 795Connection: keep-aliveLocation: https://harivishvaskyfiniatathawade.com/platform: hostingerpanel: hpanelContent-Security-Policy: upgrade-insecure-requestsServer: hcdnalt-svc: h3:443; ma86400x-hcdn-request-id: a0e417aea26455f4f41f1deb851d9808-phx-edge8x-hcdn-cache-status: MISSx-hcdn-upstream-rt: 0.475 !DOCTYPE html>html styleheight:100%>head>meta nameviewport contentwidthdevice-width, initial-scale1, shrink-to-fitno />title> 301 Moved Permanently/title>style>@media (prefers-color-scheme:dark){body{background-color:#000!important}}/style>/head>body stylecolor: #444; margin:0;font: normal 14px/20px Arial, Helvetica, sans-serif; height:100%; background-color: #fff;>div styleheight:auto; min-height:100%; > div styletext-align: center; width:800px; margin-left: -400px; position:absolute; top: 30%; left:50%;> h1 stylemargin:0; font-size:150px; line-height:150px; font-weight:bold;>301/h1>h2 stylemargin-top:20px;font-size: 30px;>Moved Permanently/h2>p>The document has been permanently moved./p>/div>/div>/body>/html>
Port 443
HTTP/1.1 200 OKDate: Tue, 02 Dec 2025 21:27:39 GMTContent-Type: text/html; charsetUTF-8Transfer-Encoding: chunkedConnection: keep-aliveVary: Accept-EncodingX-Powered-By: PHP/8.2.27platform: hostingerpanel: hpanelContent-Security-Policy: upgrade-insecure-requestsServer: hcdnalt-svc: h3:443; ma86400x-hcdn-request-id: ee9cf0cfd2a402037c638f7aef6fa1a0-phx-edge7x-hcdn-cache-status: DYNAMICx-hcdn-upstream-rt: 0.821 !DOCTYPE html>html langen>head>!-- Google Tag Manager -->script>(function(w,d,s,l,i){wlwl||;wl.push({gtm.start:new Date().getTime(),event:gtm.js});var fd.getElementsByTagName(s)0,jd.createElement(s),dll!dataLayer?&l+l:;j.asynctrue;j.srchttps://www.googletagmanager.com/gtm.js?id+i+dl;f.parentNode.insertBefore(j,f);})(window,document,script,dataLayer,GTM-N3BQFD63);/script>!-- End Google Tag Manager --> meta charsetutf-8 /> meta nameviewport contentwidthdevice-width, initial-scale1, shrink-to-fitno /> link relicon typeimage/x-icon hreffavicon.jpg /> title>Harivishva Skyfinia Offers Luxurious 2 & 3 BHK for Sell in Tathawade, Pune/title> meta namedescription contentBuy Luxurious 2 & 3 BHK Starts ₹ 91 Lacs* Onwards in Tathawade, Pune. Residential Project By Harivishva Developers. Get Complete details of Price, Offer and Amenities. /> meta namekeywords contentHarivishva Skyfinia /> link relcanonical hrefharivishvaskyfiniatathawade.com /> meta propertyog:title contentHarivishva Skyfinia Offers Luxurious 2 & 3 BHK for Sell in Tathawade, Pune /> meta propertyog:type contentharivishvaskyfiniatathawade.com /> meta propertyog:url contentharivishvaskyfiniatathawade.com /> !-- meta propertyog:image content./assets/img/bannernew.webp /> --> meta propertyog:description contentBuy Luxurious 2 & 3 BHK Starts ₹ 91 Lacs* Onwards in Tathawade, Pune. Residential Project By Harivishva Developers. Get Complete details of Price, Offer and Amenities. /> meta propertytwitter:title contentHarivishva Skyfinia Offers Luxurious 2 & 3 BHK for Sell in Tathawade, Pune /> meta propertytwitter:description contentBuy Luxurious 2 & 3 BHK Starts ₹ 91 Lacs* Onwards in Tathawade, Pune. Residential Project By Harivishva Developers. Get Complete details of Price, Offer and Amenities. /> meta propertytwitter:card contentsummary_large_image /> link relpreload href./assets/css/purestyle.css asstyle /> link reldns-prefetch href//google-analytics.com crossorigin /> link reldns-prefetch href//googletagmanager.com crossorigin /> link reldns-prefetch href//www.googleadservices.com crossorigin /> link relpreload href./assets/fonts/micon.woff2 asfont typefont/woff2 crossorigin /> link reldns-prefetch href//googleads.g.doubleclick.net crossorigin /> link relstylesheet href./assets/css/purestyle.css /> style> :root { --colorPrimary: #4f2b12; --colorSecondary: #bb762c; --colorBtn: #ffffff; } #loader { width: 100vw; height: 100vh; background-color: rgba(255, 255, 255, 1); position: fixed; top: 0; left: 0; z-index: 1040; } .loader-text { display: block; text-align: center; color: #d7d7d7; font-family: Arial, sans-serif; position: absolute; top: 50%; left: 50%; -webkit-transform: translate(-50%, -50%); -moz-transform: translate(-50%, -50%); -ms-transform: translate(-50%, -50%); -o-transform: translate(-50%, -50%); transform: translate(-50%, -50%); } #Phone { width: 60%; } @keyframes loader { 0% { filter: grayscale(0); } 50% { filter: grayscale(100%); } 100% { filter: grayscale(0); } } .loader-logo { width: 300px; -webkit-animation: loader 1.3s infinite linear; -moz-animation: loader 1.3s infinite linear; -ms-animation: loader 1.3s infinite linear; -o-animation: loader 1.3s infinite linear; animation: loader 1.3s infinite linear; } .pload { display: none; } .iti__flag-container { display: none; } section#mymap { height: 540px; } button.btn.btn-sm.btn-outline-info.sectio-bro-btn.overflow-hidden.enqModal { margin-bottom: 15px; } input#submitBtn { margin: 15px 0; } .textcolor { color: #fff; } button.btn.btn-info.micro-form-btn.effetMoveGradient.submitBtn.enqModal { margin-bottom: 15px; } a.drift-open-chat { color: #fff; } p { text-align: justify; } select.my_country_name.form-control.rounded-0.micro-form-field { float: left; display: inline-block; width: 40%; padding-left: 8px; } #phone { width: 60%; }.modal-call-btn {display: none;} /*--for thank you page --*/ .thankyou-text p { text-align: center !important; }.free-ride-mobile-section { display: none;}#ami-3.owl-carousel.owl-loaded {height: auto;}#brand .col-md-4 { text-align: end; }@media only screen and (max-width: 600px) { #brand .col-md-4 { text-align: center; }}.brand img { border-right: 1px solid #ddd; padding-right: 10px;width: 60px;}@media only screen and (max-width: 600px) {.free-ride-mobile-section { display: block; margin-top: 40px; text-align: center;}} /style>/head>body data-spyscroll data-target#navbarNav>!-- Google Tag Manager (noscript) -->noscript>iframe srchttps://www.googletagmanager.com/ns.html?idGTM-N3BQFD63height0 width0 styledisplay:none;visibility:hidden>/iframe>/noscript>!-- End Google Tag Manager (noscript) --> div idloader> span classloader-text>img src./assets/img/logo1.svg classloader-logo />/span> /div> header classmicro-nav fixed-top pload> nav classnavbar navbar-expand-lg navbar-light bg-white micro-navbar> a classnavbar-brand href/>img src./assets/img/logo1.svg classlogo />/a> button classnavbar-toggler typebutton data-togglecollapse data-target#navbarNav aria-controlsnavbarNav aria-expandedfalse aria-labelToggle navigation>span classnavbar-toggler-icon>/span>/button> div classcollapse navbar-collapse idnavbarNav> ul classnavbar-nav nav-fill> li classnav-item> a classnav-link href#home>i classmi mi-home nav-icon>/i>span classd-sm-inline d-md-none> Home/span>/a> /li> li classnav-item> a classnav-link href#pricing>i classmi mi-price nav-icon>/i> Price/a> /li> li classnav-item> a classnav-link href#sitefloorplan>i classmi mi-siteplan nav-icon>/i> Site & Floor Plan/a> /li> li classnav-item> a classnav-link href#amenities>i classmi mi-ami nav-icon>/i> Amenities/a> /li> li classnav-item> a classnav-link href#gallery>i classmi mi-gallery nav-icon>/i> Gallery/a> /li> li classnav-item> a classnav-link href#address_section>i classmi mi-location nav-icon>/i> Location/a> /li> li classnav-item> a classnav-link href#sitevisit>i classmi mi-sitevisit nav-icon>/i> Virtual Site Visit /a> /li> li classnav-item overflow-hidden> a classnav-link enqModal href# data-formmd data-titleDownload brochure data-btnDownload now data-enquiryDownload Brochure Toolbar data-redirectbrochure data-redirect-filebrochure.pdf data-togglemodal data-target#enqModal> i classmi mi-download nav-icon d-inline-block animated slideInDown infinite>/i> Download Brochure /a> /li> /ul> /div> /nav> /header>main classpload> style>.card-d-custom { width: 95%; justify-content: center; text-align: center; margin: 0 auto 15px;}/style>div idhome classcarousel slide micro-main-slider data-ridecarousel> ol classcarousel-indicators> li data-target#home data-slide-to0 classactive>/li> li data-target#home data-slide-to1>/li> /ol> div classcarousel-inner> div classcarousel-item lazyloaded> div classdesktopview>img height400 width1200 classlazyload d-block micro-main-slider-img src./assets/img/banner1.webp />/div> /div> div classcarousel-item lazyloaded> div classdesktopview>img height400 width1200 classlazyload d-block micro-main-slider-img src./assets/img/banner2.webp />/div> /div> /div>/div>div classinfo-box overflow-hidden> span classpro-status>Booking Open: Limited Time Only/span> span classpro-title>Harivishva Skyfinia/span> div styleflex-wrap: wrap; display: inline-flex;padding-bottom: 10px;> span classpro-add>At Tathawade, Pune/span> span classpro-dev>by Harivishva Developers/span> /div> div classcard-d card-d-custom> div> span classheading2>Land Parcel /span> span classheading1>6 Acres/span> /div> div> span classheading2>Floors /span> span classheading1>B1+G+4P+32 Storey/span> /div> div> span classheading2>Possession /span> span classheading1>Dec 2029/span> /div> /div> span classd-block mb-1 text-capitalize of-box offer-bg-animation> span classoffer-text-outer> span classoffer-text> Spot Booking Offersbr /> Flexible Payment Plan br /> 35+ Top Class Amenities/span> /span> /span> span classd-block stylefont-size: 14px; width: 100%; background: transparent; font-weight: bold; text-align: center; color: #fff;> /span> span classpro-tag-line> Luxurious b> 2 & 3 BHK /b> Starts at/span> span classpro-price>₹ 92 Lacs*small stylefont-size:16px;> Onwards/small> /span> button classbtn btn-info micro-form-btn enqModal effetMoveGradient effectScale data-formlg data-titleDownload Brochure data-btnDownload Now data-enquiryDownload Brochure Left Panel data-redirectenquiry data-togglemodal data-target#enqModal> Download Brochure /button>/div> section classsection shadow-sm lazyload idoverview> h1 classd-block section-heading color-primary text-capitalize>Welcome to Harivishva Skyfinia/h1> p>Harivishva Skyfinia by Harivishva Developers is a premium residential project spread across 6 acres in Tathawade, Pune. The project features 6 majestic towers with B+G+4P+32 floors, offering spacious 2BHK and 3BHK residences ranging from 787 to 1226 sq.ft. Strategically located near Dange Chowk, Nimbalkar Nagar, it provides excellent connectivity to Bhumkar Chowk (2.5 km), Mumbai-Bengaluru Highway (3 km), and Phoenix Mall (3.1 km). Designed for modern urban living, Skyfinia offers a peaceful, vehicle-free environment with 45+ luxurious amenities such as a senior citizen sit-out, gazebo, barbeque area, solar panels, video door phones, and power backup. With both podium and basement parking options, the project ensures comfort and convenience for every resident./p> p>span classmore-cont styledisplay: none;>span classd-block>Harivishva Skyfinia Tathawade redefines contemporary living with its thoughtfully planned 2BHK and 3BHK premium homes, combining elegance, comfort, and functionality. Each tower features 4 apartments per floor with 3 lifts and 2 staircases, ensuring space and privacy. Residents enjoy a serene lifestyle enriched with internal and external amenities while staying close to key IT hubs, schools, hospitals, and entertainment destinations. Harivishva Skyfinia stands out as one of the most promising residential developments in Tathawade, Pune./span>/span> a href#! classbtn btn-link btn-sm more>Read more/a>/p> button classbtn btn-info micro-form-btn effetMoveGradient enqModal data-formmd data-titleDownload Brochure data-btnDownload Now data-enquiryDownload Brochure Welcome Text data-redirectbrochure data-redirect-filebrochure.pdf data-togglemodal data-target#enqModal > span classd-inline-block mi mi-download mr-1 animated slideInDown infinite>/span> Download Brochure /button> div classfree-ride-mobile-section> img stylewidth: 80%; margin: 20px 0; classbook-ride src./assets/img/free-site-visit.png alt> button classbtn btn-info micro-form-btn enqModal effetMoveGradient effectScale data-formlg data-titleBook A Free Site Visit data-btnBook Now data-enquiryBook A Free Site Visit Left Panel data-redirectenquiry data-togglemodal data-target#enqModal>Book A Free Site Visit/button>/div> /section> section classsection shadow-sm lazyload idpricing> span classsection-link>/span> span classhead text-capitalize>Price/span> div classrow> div classcol-md-8> table classtable table-striped table-borderless border micro-price-table table-pricing> thead> tr> th scopecol classborder border-bottom-0 mb-w>Type/th> th scopecol classborder border-bottom-0 mb-w>Carpet Area/th> th scopecol classborder border-bottom-0 border-right-0>Price/th> th scopecol>/th> /tr> /thead> tbody> tr> td classborder border-left-0 border-top-0 border-bottom-0 price-type> 2 BHK /td> td classborder border-left-0 border-top-0 border-bottom-0 price-carpet> 787 Sq.ft. /td> td classprice-amt>i classmi mi-rs-light>/i> 92 Lacs*/td> td> button classbtn btn-sm btn-info effetGradient effectScale enqModal data-formlg data-titleSend me costing details data-btnSend Now data-enquiryPrice Breakup data-redirectfloorplan data-togglemodal data-target#enqModal>Price Breakup/button> /td> /tr> tr> td classborder border-left-0 border-top-0 border-bottom-0 price-type> 2 BHK /td> td classborder border-left-0 border-top-0 border-bottom-0 price-carpet> 837 Sq.ft. /td> td classprice-amt>i classmi mi-rs-light>/i> 97 to 1.05 Cr* /td> td> button classbtn btn-sm btn-info effetGradient effectScale enqModal data-formlg data-titleSend me costing details data-btnSend Now data-enquiryPrice Breakup data-redirectfloorplan data-togglemodal data-target#enqModal>Price Breakup/button> /td> /tr> tr> td classborder border-left-0 border-top-0 border-bottom-0 price-type> 3 BHK /td> td classborder border-left-0 border-top-0 border-bottom-0 price-carpet> 1109 Sq.ft. /td> td classprice-amt>i classmi mi-rs-light>/i> 1.33 Cr*/td> td> button classbtn btn-sm btn-info effetGradient effectScale enqModal data-formlg data-titleSend me costing details data-btnSend Now data-enquiryPrice Breakup data-redirectfloorplan data-togglemodal data-target#enqModal>Price Breakup/button> /td> /tr> tr> td classborder border-left-0 border-top-0 border-bottom-0 price-type> 3 BHK /td> td classborder border-left-0 border-top-0 border-bottom-0 price-carpet> 1226 Sq.ft. /td> td classprice-amt>i classmi mi-rs-light>/i> 1.46 Cr*/td> td> button classbtn btn-sm btn-info effetGradient effectScale enqModal data-formlg data-titleSend me costing details data-btnSend Now data-enquiryPrice Breakup data-redirectfloorplan data-togglemodal data-target#enqModal>Price Breakup/button> /td> /tr> /tbody> /table> /div> div classcol-md-4> a href# classtext-decoration-none enqModal data-formlg data-titleSend me costing details data-btnSend Now data-enquiryComplete Costing Details data-togglemodal data-target#enqModal> div classat-property-item shadow-sm border border-grey mt-1> div classat-property-img lazyloaded data-expand-1> img data-sizesauto classw-100 lazyautosizes ls-is-cached lazyloaded ls-inview sizes304px src./assets/img/costing.webp> div classat-property-overlayer>/div> span classbtn btn-default at-property-btn>Enquire Now/span> /div> div classat-property-dis effetGradient> h5>Complete Costing Details/h5> /div> /div> /a> /div> /div>/section> section classsection shadow-sm lazyload idsitefloorplan data-scripthttps://cdn.jsdelivr.net/gh/fancyapps/fancybox@3.5.7/dist/jquery.fancybox.min.js data-linkhttps://cdn.jsdelivr.net/gh/fancyapps/fancybox@3.5.7/dist/jquery.fancybox.min.css> span classsection-link >/span> h2 classhead text-capitalize>Site & Floor Plan of Harivishva Skyfinia/h2> span classd-block section-heading-sub text-capitalize>Master Plan/span> div classmasterplan-box> a href# classtext-decoration-none enqModal data-formlg data-titleSend me plan details data-btnSend Now data-enquiryGet Master Plan data-redirectenquiry data-togglemodal data-target#enqModal> div classat-property-item mt-1> div classat-property-img master-plan text-center> img data-sizesauto classlazyload shadow-sm border border-grey src./assets/img/floorplan/masterplan.webp /> div classat-property-overlayer>/div> span classat-property-btn>View Master Plan /span> /div> /div> /a>/div> span classd-block section-heading-sub text-capitalize>Floor Plan/span> !-- button classbtn btn-sm btn-info effetGradient effectScale enqModal data-formlg data-titleSend me plan details data-btnSend now data-enquiryGet Floor Plan data-redirectenquiry data-togglemodal data-target#enqModal>On Request/button> --> div classrow row-cols-1 row-cols-md-3> div classcol-md-6> a href# classtext-decoration-none enqModal data-formlg data-titleSend me plan details data-btnSend now data-enquiryGet Floor Plan data-redirectenquiry data-togglemodal data-target#enqModal> div classat-property-item shadow-sm border border-grey mt-1> div classat-property-img> img data-sizesauto classfloor-plan-img blur lazyautosizes ls-is-cached lazyloaded ls-inview loadinglazy src./assets/img/floorplan/2bhk.webp sizes464px> div classat-property-overlayer>/div> span classbtn btn-default at-property-btn rolebutton>Enquire Now/span> /div> div classat-property-dis effetGradient>h5>2 BHK 787-837 Sq.ft. /h5>/div> /div> /a> /div> div classcol-md-6> a href# classtext-decoration-none enqModal data-formlg data-titleSend me plan details data-btnSend now data-enquiryGet Floor Plan data-redirectenquiry data-togglemodal data-target#enqModal> div classat-property-item shadow-sm border border-grey mt-1> div classat-property-img> img data-sizesauto classfloor-plan-img blur lazyautosizes ls-is-cached lazyloaded ls-inview loadinglazy src./assets/img/floorplan/3bhk.webp sizes464px> div classat-property-overlayer>/div> span classbtn btn-default at-property-btn rolebutton>Enquire Now/span> /div> div classat-property-dis effetGradient>h5>3 BHK 1109 – 1226 Sq.ft. /h5>/div> /div> /a> /div> /div> /section> section classsection shadow-sm lazyload idamenities> span classsection-link >/span> div classrow> div classcol-md-8> h2 classhead text-capitalize>Amenities of Harivishva Skyfinia/h2> /div> div classcol-md-4> button classbtn btn-info micro-form-btn enqModal effetMoveGradient effectScale float-lg-right mx-sm-auto d-none d-lg-block data-formlg data-titleDownload Amenities data-btnSend Now data-enquiryDownload Amenities data-redirectfloorplan data-togglemodal data-target#enqModal>Download Amenities/button> /div> /div> div idami-3 classami-3 owl-carousel owl-theme> div classitem-wrp> div classami_sec> img data-src./assets/img/amenities/zumba.webp loadinglazy classlazyload /> p>Zumba/Yoga Area/p> /div> div classami_sec> img data-src./assets/img/amenities/badmintorcourt.webp loadinglazy classlazyload /> p>Pickelball Court/p> /div> /div> div classitem-wrp> div classami_sec> img data-src./assets/img/amenities/basketcourt.jpg loadinglazy classlazyload /> p>Basket Court/p> /div> div classami_sec> img data-src./assets/img/amenities/bbqlawn.jpg loadinglazy classlazyload /> p>BBQ Lawn/p> /div> /div> div classitem-wrp> div classami_sec> img data-src./assets/img/amenities/clubhous.jpg loadinglazy classlazyload /> p>Club House/p> /div> div classami_sec> img data-src./assets/img/amenities/gymansium.webp loadinglazy classlazyload /> p>Gymansium/p> /div> /div> div classitem-wrp> div classami_sec> img data-src./assets/img/amenities/indoorgames.jpg loadinglazy classlazyload /> p>Indoor Games/p> /div> div classami_sec> img data-src./assets/img/amenities/kidsplayarea.jpg loadinglazy classlazyload /> p>Kids Play Area/p> /div> /div> div classitem-wrp> div classami_sec> img data-src./assets/img/amenities/kidspool.jpg loadinglazy classlazyload /> p>Kids Pool/p> /div> div classami_sec> img data-src./assets/img/amenities/jogtrack.webp loadinglazy classlazyload /> p>Jogging Track/p> /div> /div> div classitem-wrp> div classami_sec> img data-src./assets/img/amenities/partylawn.webp loadinglazy classlazyload /> p>Party Lawn/p> /div> div classami_sec> img data-src./assets/img/amenities/seniorcitizenarea.jpg loadinglazy classlazyload /> p>Senior Citizen Area/p> /div> /div> /div> div classcol-12> p>/p> button classbtn btn-info micro-form-btn enqModal effetMoveGradient effectScale float-lg-right mx-sm-auto d-lg-none data-formlg data-titleDownload Amenities data-btnSend Now data-enquiryDownload Amenities data-redirectfloorplan data-togglemodal data-target#enqModal>Download Amenities/button> /div>/section> section classsection shadow-sm lazyload idgallery> span classsection-link >/span> div classrow> div classcol-md-8> h2 classhead text-capitalize>Gallery of Harivishva Skyfinia/h2> /div> div classcol-md-4> button classbtn btn-info micro-form-btn enqModal effetMoveGradient effectScale float-lg-right mx-sm-auto d-none d-lg-block data-formlg data-titleDownload Gallery data-btnSend Now data-enquiryDownload Gallery data-redirectfloorplan data-togglemodal data-target#enqModal>Download Gallery/button> /div> /div> div classrow> div classcol-lg-3 col-md-4 col-sm-6 col-6 mb-2> a data-fancyboxgallery-0 href./assets/img/gallery/gallery1.webp> img data-src./assets/img/gallery/gallery1.webp loadinglazy classlazyload gallery-thumb /> /a> /div> div classcol-lg-3 col-md-4 col-sm-6 col-6 mb-2> a data-fancyboxgallery-0 href./assets/img/gallery/gallery2.webp> img data-src./assets/img/gallery/gallery2.webp loadinglazy classlazyload gallery-thumb /> /a> /div> div classcol-lg-3 col-md-4 col-sm-6 col-6 mb-2> a data-fancyboxgallery-0 href./assets/img/gallery/gallery3.webp> img data-src./assets/img/gallery/gallery3.webp loadinglazy classlazyload gallery-thumb /> /a> /div> div classcol-lg-3 col-md-4 col-sm-6 col-6 mb-2> a data-fancyboxgallery-0 href./assets/img/gallery/gallery4.webp> img data-src./assets/img/gallery/gallery4.webp loadinglazy classlazyload gallery-thumb /> /a> /div> /div> div classcol-12> p>/p> button classbtn btn-info micro-form-btn enqModal effetMoveGradient effectScale float-lg-right mx-sm-auto d-lg-none data-formlg data-titleDownload Gallery data-btnSend Now data-enquiryDownload Gallery data-redirectfloorplan data-togglemodal data-target#enqModal>Download Gallery/button> /div> /section> style>iframe {width: 100%;height: 38vh;border: 2px solid #d7d7d7;}@media only screen and (max-width: 1024px) {iframe {width: 100%;height: 32vh;border: 2px solid #d7d7d7;}} @media only screen and (max-width: 992px) {iframe {width: 100%;height: 18vh;border: 2px solid #d7d7d7;}} @media only screen and (max-width: 800px) {iframe {width: 100%;height: 26vh;border: 2px solid #d7d7d7;}} @media only screen and (max-width: 768px) {iframe {width: 100%;height: 20vh;border: 2px solid #d7d7d7;}} @media only screen and (max-width: 500px) {iframe {width: 100%;height: 50vh;border: 2px solid #d7d7d7;}} /style>section idaddress_section classsection shadow-sm lazyloaded> /section> section classsection shadow-sm lazyloaded idsitevisit> span classsection-link>/span> span classhead text-capitalize>Virtual Tour Request/span> a href# classenqModal data-formlg data-titleVirtual Site Visit data-btnStart Tour data-enquiryVirtual Site Visit data-redirectvirtualtour data-togglemodal data-target#enqModal> div classat-property-item my-2 pt-md-0> div classat-property-img vsv-img lazyloaded data-expand-1> div classd-none d-xs-none d-sm-none d-md-block d-lg-block> img classimg-responsive src./assets/img/virtualtour.jpg width100% /> /div> div classd-block d-xs-block d-sm-block d-md-none d-lg-none> img classimg-responsive src./assets/img/virtualtour.jpg width100% /> /div> div classvsv-text-bk> div classvsv-text-bg> div classvsv-icon lazyloaded>/div> span classtext-uppercase h1 font-weight-bold mb-0 d-none d-lg-block>Virtual Site Visit/span> span classtext-capitalize text-center d-none d-lg-block> Harivishva Skyfinia /span> /div> /div> /div> /div> span classtext-center d-block d-lg-none content-clr>Virtual Site visit/span> /a> /section> section classsection shadow-sm lazyload iddeveloper> div classd-block pt-2 pb-1 text-center>img src./assets/img/logo1.svg loadinglazy stylemax-width: 100%; height: 65px; display: inline-block; />/div> div classrow> div classcol-md-8> span classd-block section-heading-sub text-capitalize>About Harivishva Developers/span> /div> div classcol-md-4> /div> /div> p>Harivishva Developers is a real estate development company recognized for its meticulous planning, customer-focused philosophy, and unwavering commitment to quality. The company specializes in creating homes that stand out for their thoughtful design, superior construction, and lasting value. Founded by Mr. Harish Navale and Mr. Prashant Gaikwad, Harivishva Developers strives to inspire growth and craft living spaces that fulfill the needs and aspirations of modern homebuyers./p> span classd-block section-heading-sub1 text-capitalize>RERA Information/span> div classrow> div classcol-md-12> div classrera-box> div classrera-img> img src./assets/img/qrcode/qrcode.webp loadinglazy stylemax-width: 100%; height: 100px; display: inline-block;> /div> div classrera-details> p>Harivishva Skyfinia Maharera Details b> P52100052385/b>/p> /div> /div> /div>/div>/section>section classsection shadow-sm lazyload idbrand> div classrow> /div> small>Nirmaan Projects Agent RERA No: A51800044741/small>br> small>strong>Contact Us: /strong>Spaces Inspire Hub, Level 1 & 2, Adani Western Heights, Near Four Bunglows, J P Road, Andheri, West, Mumbai, Maharashtra – 400053/small>/section>section styletext-align:justify;background:#f7f7f7 !important; classsection shadow-sm lazyload iddeveloper>small> style>.newlist { list-style: none; line-height: 25px; padding-left: 22px; text-align: left;}.newlist li:before { content: ✓; font-weight: 800; margin-right: 10px; font-size: 13px; margin-left: -22px;} /style>b>Disclaimer:/b>We are an authorised marketing partner for this project. Provided content is given by respective owners and this website and content is for information purpose only and it does not constitute any offer to avail for any services. Prices mentioned are subject to change without prior notice and properties mentioned are subject to availability. You can expect a call, SMS or emails on details registered with us.hr>p styletext-align:center;>Copyright © 2025 | a hrefterms-conditions.php>Terms & Conditions/a> | a hrefprivacy-policy.php>Privacy Policy/a> | a hrefcookies-policy.php>Cookies Policy/a> /p>/small>/section>/main>style>.action-icon img { height: 22px; width: auto; margin-right: 7px; /*margin-right: 4px;*/}.ft-main { display: flex; justify-content: center; align-items: center; width: 100%; padding: 0% 2%; font-size: 14px;}.ft-left { width: 82%;}.ft-right { width: 16%;}.acceptcookies { font-size: 16px; padding: 3px 30px;}.cstm-blur { filter: blur(4px);}@media (min-width: 1920px) and (max-width: 2560px) { .ft-main { font-size: 19px; }}@media (min-width: 2561px) and (max-width: 5120px) { .ft-main { font-size: 36px; }}@media (min-width: 1920px) and (max-width: 5120px) { .acceptcookies { font-size: 46px; padding: 3px 30px; }}@media (min-width: 320px) and (max-width: 767px) { .ft-main { display: block; } .ft-left { width: 100%; text-align: justify; } .ft-right { width: 100%; } .acceptcookies { margin-top: 10px; margin-left: 0px !important; }}/style>!--exit modal 1 start -->div classmodal fade lightbox idenqModal233 tabindex-1 roledialog aria-hiddentrue>/div>!--Exit modal 1 end-->!--exit modal 2 start -->div classmodal fade lightbox2 abc>/div>!--exit modal 2 end -->div classmicro-side text-center> div classog-section pb-2> ul classnav nav-fill og-block> li classnav-item enqModal data-formlg data-titleBook Site Visit data-btnRegister Now data-enquiryOrganize Site Visit data-togglemodal data-target#enqModal>Book Site Visit /li> /ul> button classbtn btn-sm btn-info micro-form-btn-sm effetGradient effectScale enqModal mt-1 data-formsm data-titleImmediate Call Back data-btnRequest Call Now data-enquiryRequest Call Back data-togglemodal data-target#enqModal> span classmi mi-call action-icon>/span> Instant Call Back /button> /div> span classd-block form-heading font-weight-bold my-2>Get The Best Quote /span> form actionsubmit.php methodPOST classform-side idleadForm> input typetext idFirstName namefirstName placeholderFull Name classform-control rounded-0 micro-form-field required> input typehidden idLastName namelastName > input typeEmailAddress idEmailAddress nameemail placeholderEmail Address classform-control rounded-0 micro-form-field required> select classmy_country_name form-control rounded-0 micro-form-field idcountry namecountry> option data-countrycodeIN valueIndia data-contry_code91>India (+91)/option> option data-countrycodeAE valueUnited Arab Emirates data-contry_code971>Abu Dhabi (+971)/option> option data-countrycodeAE valueUnited Arab Emirates data-contry_code973>Bahrain (+973)/option> option data-countrycodeAE valueUnited Arab Emirates data-contry_code971>Dubai (+971)/option> option data-countrycodeDE valueGermany data-contry_code49>Germany (+49)/option> option data-countrycodeHK valueHong Kong data-contry_code852>Hong Kong (+852)/option> option data-countrycodeID valueIndonesia data-contry_code62>Indonesia (+62)/option> option data-countrycodeKE valueKenya data-contry_code254>Kenya (+254)/option> option data-countrycodeKE valueNairobi data-contry_code254>Nairobi (+254)/option> option data-countrycodeNL valueNetherlands data-contry_code31>Netherlands (+31)/option> option data-countrycodeNZ valueNew Zealand data-contry_code64>New Zealand(+64)/option> option data-countrycodeQA valueQatar data-contry_code974>Qatar (+974)/option> option data-countrycodeSA valueSaudi Arabia data-contry_code966>Saudi Arabia (+966)/option> option data-countrycodeAE valueUnited Arab Emirates data-contry_code971>Sharjah (+971)/option> option data-countrycodeSG valueSingapore data-contry_code65>Singapore (+65)/option> option data-countrycodeAE valueUnited Arab Emirates data-contry_code971>United Arab Emirates (+971)/option> option data-countrycodeOther valueOther Country data-contry_code>Other add country code/option> /select> input typetext idPhone namePhone placeholderPhone Number classform-control numeric rounded-0 micro-form-field pattern1-9{1}0-9{9} titleEnter 10 digit mobile number required> input typehidden idmx_projectName namemx_projectName valueHarivishva Skyfinia Pune W T2 classform-control rounded-0 micro-form-field> input typehidden idmx_Team namemx_Team valueT2 classform-control rounded-0 micro-form-field> input typehidden idsource namesource valueMicrosite classform-control rounded-0 micro-form-field> input typehidden idrequirementType namerequirementType > input typehidden idmx_utm_source namemx_utm_source value> input typehidden idmx_utm_content namemx_utm_content value> input typehidden idmx_utm_term namemx_utm_term value> input typehidden idmx_utm_medium namemx_utm_medium value> input typehidden idmx_utm_campaign namemx_utm_campaign value> input typehidden idmx_utm_Physical_Location namemx_utm_Physical_Location value> input typehidden idmx_utm_Target namemx_utm_Target value> input typehidden idmx_utm_Targetid namemx_utm_Targetid value> input typehidden idmx_utm_Placement namemx_utm_Placement value> input typehidden idmx_utm_Gclid namemx_utm_Gclid value> input typehidden idCompany nameCompany valueHarivishva Developers> input typehidden idSourceReferrerURL nameSourceReferrerURL valuehttps://harivishvaskyfiniatathawade.com/> input typetext namehoneypot styledisplay:none;> div classcustom-control custom-checkbox custom-checkbox-green text-left stylefont-size: 9px; color: #333333; padding-top:8px;> input typecheckbox checked required classcustom-control-input custom-control-input-green idcustomCheck3> label classcustom-control-label forcustomCheck3> I Consent to The Processing of Provided Data According To a hrefprivacy-policy.php target_self>Privacy Policy | Terms & Conditions/a>. /label> /div> button typesubmit classbtn btn-info micro-form-btn effetMoveGradient submitBtn idsubmitBtn stylemargin-top:10px;margin-bottom:10px namesubmitBtn valuesendCRM>Get Instant Call Back/button>/form> div classfree-ride-section> img stylewidth: 80%; margin: 20px 0; classbook-ride src./assets/img/free-site-visit.png alt> button classbtn btn-info micro-form-btn enqModal effetMoveGradient effectScale data-formlg data-titleBook A Free Site Visit data-btnBook Now data-enquiryBook A Free Site Visit Left Panel data-redirectenquiry data-togglemodal data-target#enqModal> Book A Free Site Visit /button> /div>/div>div classmodal fade idenqModal tabindex-1 roledialog aria-hiddentrue> div classmodal-dialog modal-dialog-centered enq-modal roledocument> div classmodal-content> div classmodal-body text-center> button typebutton classclose data-dismissmodal aria-labelClose>span aria-hiddentrue>×/span>/button> div classmodal-head d-none>span classmodal-title> Download Brochure/span>/div> div classd-flex> div classflex-fill align-self-center flex-shrink-1 modal-highlight-bg d-none d-lg-block> span classmodal-highlight-title>We Promise/span> ul classmodal-highlight> li>i classmi mi-support-call>/i>span>Instant Call Back/span>/li> li>i classmi mi-support-visit>/i>span>Free Site Visit/span>/li> li>i classmi mi-support-price>/i>span>Unmatched Price/span>/li> /ul> /div> div classflex-fill align-self-center> span classpopup-logo>img src./assets/img/logo1.svg classlogo>/span> span classmodal-title-secondary> Register here and Avail the span classtext-danger>Best Offers!!/span>/span> form actionsubmit.php methodPOST classform-side idleadForm> input typetext idFirstName namefirstName placeholderFull Name classform-control rounded-0 micro-form-field required> input typehidden idLastName namelastName > input typeEmailAddress idEmailAddress nameemail placeholderEmail Address classform-control rounded-0 micro-form-field required> select classmy_country_name form-control rounded-0 micro-form-field idcountry namecountry> option data-countrycodeIN valueIndia data-contry_code91>India (+91)/option> option data-countrycodeAE valueUnited Arab Emirates data-contry_code971>Abu Dhabi (+971)/option> option data-countrycodeAE valueUnited Arab Emirates data-contry_code973>Bahrain (+973)/option> option data-countrycodeAE valueUnited Arab Emirates data-contry_code971>Dubai (+971)/option> option data-countrycodeDE valueGermany data-contry_code49>Germany (+49)/option> option data-countrycodeHK valueHong Kong data-contry_code852>Hong Kong (+852)/option> option data-countrycodeID valueIndonesia data-contry_code62>Indonesia (+62)/option> option data-countrycodeKE valueKenya data-contry_code254>Kenya (+254)/option> option data-countrycodeKE valueNairobi data-contry_code254>Nairobi (+254)/option> option data-countrycodeNL valueNetherlands data-contry_code31>Netherlands (+31)/option> option data-countrycodeNZ valueNew Zealand data-contry_code64>New Zealand(+64)/option> option data-countrycodeQA valueQatar data-contry_code974>Qatar (+974)/option> option data-countrycodeSA valueSaudi Arabia data-contry_code966>Saudi Arabia (+966)/option> option data-countrycodeAE valueUnited Arab Emirates data-contry_code971>Sharjah (+971)/option> option data-countrycodeSG valueSingapore data-contry_code65>Singapore (+65)/option> option data-countrycodeAE valueUnited Arab Emirates data-contry_code971>United Arab Emirates (+971)/option> option data-countrycodeOther valueOther Country data-contry_code>Other add country code/option> /select> input typetext idPhone namePhone placeholderPhone Number classform-control numeric rounded-0 micro-form-field pattern1-9{1}0-9{9} titleEnter 10 digit mobile number required> input typehidden idmx_projectName namemx_projectName valueHarivishva Skyfinia Pune W T2 classform-control rounded-0 micro-form-field> input typehidden idmx_Team namemx_Team valueT2 classform-control rounded-0 micro-form-field> input typehidden idsource namesource valueMicrosite classform-control rounded-0 micro-form-field> input typehidden idrequirementType namerequirementType > input typehidden idmx_utm_source namemx_utm_source value> input typehidden idmx_utm_content namemx_utm_content value> input typehidden idmx_utm_term namemx_utm_term value> input typehidden idmx_utm_medium namemx_utm_medium value> input typehidden idmx_utm_campaign namemx_utm_campaign value> input typehidden idmx_utm_Physical_Location namemx_utm_Physical_Location value> input typehidden idmx_utm_Target namemx_utm_Target value> input typehidden idmx_utm_Targetid namemx_utm_Targetid value> input typehidden idmx_utm_Placement namemx_utm_Placement value> input typehidden idmx_utm_Gclid namemx_utm_Gclid value> input typehidden idCompany nameCompany valueHarivishva Developers> input typehidden idSourceReferrerURL nameSourceReferrerURL valuehttps://harivishvaskyfiniatathawade.com/> input typetext namehoneypot styledisplay:none;> div classcustom-control custom-checkbox custom-checkbox-green text-left stylefont-size: 9px; color: #333333; padding-top:8px;> input typecheckbox checked required classcustom-control-input custom-control-input-green idcustomCheck3> label classcustom-control-label forcustomCheck3> I Consent to The Processing of Provided Data According To a hrefprivacy-policy.php target_self>Privacy Policy | Terms & Conditions/a>. /label> /div> button typesubmit classbtn btn-info micro-form-btn effetMoveGradient submitBtn idsubmitBtn stylemargin-top:10px;margin-bottom:10px namesubmitBtn valuesendCRM>Get Instant Call Back/button>/form> /div> /div> !--Privacy Policy LINK--> small classmodal-call-btn> !--CONTACT NO--> a hreftel: classmodal-call-btn styledisplay: inline-block;justify-content: center;width: fit-content;padding: 0.5rem 1rem; margin-bottom: 0.5rem; background-color: var(--colorPrimary);color: var(--colorBtn);text-decoration: none;border-radius: 4px;>i classmi mi-call>/i>/a> /small> /div> /div> /div>/div>!--COOKIES CODE START-->style>.cookiealert { position: fixed; bottom: 0; left: 0; width: 100%; margin: 0 !important; z-index: 9999; opacity: 0; visibility: hidden; border-radius: 0; transform: translateY(100%); transition: all 500ms ease-out; color: #ecf0f1; background: #212327;}.cookiealert.show { opacity: 1; visibility: visible; transform: translateY(0%); transition-delay: 1000ms;}.cookiealert a { text-decoration: underline}.cookiealert .acceptcookies { margin-left: 10px; vertical-align: baseline;}.wa-widget-send-button { margin-bottom: 50px !important;}.wa-chat-bubble-text { margin-bottom: 25px;}/style>script>(function() { use strict; var cookieAlert document.querySelector(.cookiealert); var acceptCookies document.querySelector(.acceptcookies); if (!cookieAlert) { return; } cookieAlert.offsetHeight; // Show the alert if we cant find the acceptCookies cookie if (!getCookie(acceptCookies)) { cookieAlert.classList.add(show); } // When clicking on the agree button, create a 1 year // cookie to remember users choice and close the banner acceptCookies.addEventListener(click, function() { setCookie(acceptCookies, true, 365); cookieAlert.classList.remove(show); // dispatch the accept event window.dispatchEvent(new Event(cookieAlertAccept)) }); // Cookie functions from w3schools function setCookie(cname, cvalue, exdays) { var d new Date(); d.setTime(d.getTime() + (exdays * 24 * 60 * 60 * 1000)); var expires expires + d.toUTCString(); document.cookie cname + + cvalue + ; + expires + ;path/; } function getCookie(cname) { var name cname + ; var decodedCookie decodeURIComponent(document.cookie); var ca decodedCookie.split(;); for (var i 0; i ca.length; i++) { var c cai; while (c.charAt(0) ) { c c.substring(1); } if (c.indexOf(name) 0) { return c.substring(name.length, c.length); } } return ; }})();/script>!--COOKIES CODE END-->script src./assets/js/jquery.min.js>/script>script src./assets/js/app1_min.js>/script>!-- Start of Async Drift Code -->script deferdefer>var executed true;var h1tag Harivishva Skyfinia;window.onscroll function() { if (executed) { document.querySelector(#address_section).insertAdjacentHTML(afterbegin, ` span classsection-link idlocation>/span> span classhead text-capitalize>Address of ${h1tag}/span> div classrow mb-3> div classcol-md-7 col-sm-12 map-view> span classd-block section-heading-sub text-capitalize text-center>Map View/span> iframe srchttps://www.google.com/maps/embed?pb!1m18!1m12!1m3!1d3780.981630799977!2d73.75872887417206!3d18.61989596613469!2m3!1f0!2f0!3f0!3m2!1i1024!2i768!4f13.1!3m3!1m2!1s0x3bc2b904a5781843%3A0x3a3c0edb9198d8f6!2sHarivishva%20Skyfinia!5e0!3m2!1sen!2sin!4v1762756966687!5m2!1sen!2sin width600 height450 styleborder:0; allowfullscreen loadinglazy referrerpolicyno-referrer-when-downgrade>/iframe> /div> div classcol-md-5 col-sm-12 lmap-div text-center location> span classd-block section-heading-sub text-capitalize text-center>Location Map/span> a href# classtext-decoration-none enqModal data-formlg data-titleDownload Location Map data-btnDownload now data-enquiryView Location Map data-togglemodal data-target#enqModal> div classat-property-item mb-2> div classat-property-img master-plan lazyloaded data-expand-1> img classshadow-sm border border-grey lazyautosizes ls-is-cached cstm-blur lazyloaded ls-inview src./assets/img/locationmap.webp> div classat-property-overlayer>/div> span classat-property-btn>Download Location Map/span> /div> /div> /a> /div> /div> p>/p> div classrow row-cols-1 row-cols-sm-2 row-cols-md-3> div classcol my-2>i classmi mi-loc-list-2 color-primary loc-icon>/i> Bhumkar Chowk - 2.5km/div> div classcol my-2>i classmi mi-loc-list-2 color-primary loc-icon>/i> Mumbai-Bengaluru Highway - 3km/div> div classcol my-2>i classmi mi-loc-list-2 color-primary loc-icon>/i> Phoenix Mall - 3.1km/div> div classcol my-2>i classmi mi-loc-list-2 color-primary loc-icon>/i> Aditya Birla Hospital - 4km/div> div classcol my-2>i classmi mi-loc-list-2 color-primary loc-icon>/i> Hinjewadi IT Park - 6.5 km/div> div classcol my-2>i classmi mi-loc-list-2 color-primary loc-icon>/i> Bhumkar Chowk - 3km/div> /div> `); executed false; }};/script>!-- Onload start -->script typetext/javascript>$(document).ready(function() { $(inputnamemodal_my_mobile2).focusout(function() { $(.mobileconcat).val(+ + $(#country_code).val() + $(this).val()); }); // on country name field change $(selectnamecountry_name).focusout(function() { $(.mobileconcat).val(+ + $(#country_code).val() + $(this).siblings( inputnamemodal_my_mobile2).val()); }); $(select.my_country_name).change(function() { var capacityValue $(option:selected, this).data(contry_code); $(.operations-supplierCapacity).val(capacityValue); }); // Split Form Name into First name and Last Name $(inputnamefname).focusout(function() { var name $(this).val(); var first_name name.substr(0, name.indexOf( )); var last_name name.substr(name.indexOf( ) + 1); $(inputnamefirst_name).val(first_name); $(inputnamelast_name).val(last_name); });});/script>!-- Onload end -->script>document.addEventListener(DOMContentLoaded, function(event) { document.getElementById(loader).remove(); document.querySelector(header).classList.remove(pload); document.querySelector(main).classList.remove(pload);});var sitePrimaryColor #2C2969;/script>script>var c, a window.location.pathname, d a.substring(a.lastIndexOf(/) + 1);if (d ! thank-you.php) { function addEvent(obj, evt, fn) { if (obj.addEventListener) { obj.addEventListener(evt, fn, false); } else if (obj.attachEvent) { obj.attachEvent(on + evt, fn); } } addEvent(document, mouseout, function(evt) { let windowHeight window.innerHeight; if (evt.toElement null && evt.relatedTarget null && (evt.y 0 || evt.y > windowHeight)) { if (sessionStoragePopupShown ! yes && $(#enqModal).css(display) none) { sessionStoragePopupShown yes; $(#enqModal .modal-head).removeClass(d-none); $(#enqModal .modal-call-btn).addClass(d-none); $(#enqModal .modal-title).text(Virtual Site Visit), $(#enqModal .micro-form-btn).text(Start Tour), $(#enqModal #enquiredfor).val(Virtual Tour Exit intent popup), $(#enqModal).modal(show); } }; }); sessionStorage.clear(); var available; var percentage_of_page; var half_screen; var height; $(window).scroll(function(e) { available $(document).height(); percentage_of_page 0.5; half_screen available * percentage_of_page; height $(window).scrollTop(); // alert(height) if (height > half_screen) { if (sessionStoragePopupShown1 ! yes1 && $(#enqModal).css(display) none) { sessionStoragePopupShown1 yes1; sessionStoragePopupShown yes; $(#enqModal .modal-head).removeClass(d-none); $(#enqModal .modal-call-btn).addClass(d-none); $(#enqModal .modal-title).text(Virtual Site Visit), $(#enqModal .micro-form-btn).text(Start Tour), $(#enqModal #enquiredfor).val(Virtual Tour Exit intent popup on scroll), $(#enqModal).modal(show); } } else { $(.lightbox).hide(); } });}/script>script> // Disable submit button if already submitted document.addEventListener(DOMContentLoaded, function() { var alreadySubmitted false; if (alreadySubmitted) { document.getElementById(submitBtn).disabled true; alert(Your form has been already submitted.); } });/script>script>session_start();if (isset($_GETutm_source)) { $_SESSIONutm_source $_GETutm_source;}if (isset($_GETutm_content)) { $_SESSIONutm_content $_GETutm_content;}if (isset($_GETutm_medium)) { $_SESSIONutm_medium $_GETutm_medium;}if (isset($_GETutm_campaign)) { $_SESSIONutm_campaign $_GETutm_campaign;}if (isset($_GETutm_term)) { $_SESSIONutm_term $_GETutm_term;}if (isset($_GETutm_content)) { $_SESSIONutm_content $_GETutm_content;}if (isset($_GETutm_physical_location)) { $_SESSIONutm_physical_location $_GETutm_physical_location;}/script>script> document.addEventListener(contextmenu, function(event) { event.preventDefault(); }); document.addEventListener(keydown, function(event) { // Disable F12 if (event.key F12) { event.preventDefault(); } if (event.ctrlKey && event.shiftKey && (event.key I || event.key J)) { event.preventDefault(); } if (event.ctrlKey && event.shiftKey && event.key I) { event.preventDefault(); } if (event.keyCode 123) { // F12 return false; } }); window.addEventListener(keydown, function(e) { // Disable F12 key if (e.keyCode 123) { return false; } if (e.ctrlKey && e.shiftKey && (e.key I || e.key J)) { return false; } }); document.oncontextmenu function() { return false; // Disable right-click }; document.addEventListener(mousedown, function(event) { if (event.button 2) { // Right-click event.preventDefault(); } });/script>script> function onSubmit(token) { document.getElementById(leadForm).submit(); }/script>/body>/html>
View on OTX
|
View on ThreatMiner
Please enable JavaScript to view the
comments powered by Disqus.
Data with thanks to
AlienVault OTX
,
VirusTotal
,
Malwr
and
others
. [
Sitemap
]